Rabbit anti-Human ZNF324 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08261P

• Product Name:
• Rabbit anti-Human ZNF324 Polyclonal Antibody

• Synonym:
• ZNF324; ZF5128; ZNF324A; zinc finger protein 324

• Description:
• The antibody against ZNF324 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 271-553 of human ZNF324(NP_055162.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 271-553 of human ZNF324(NP_055162.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZNF324

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DLLKHLRTHTGERPYECAQCGKAFSQTSHLTQHQRIHSGETPYACPVCGKAFRHSSSLVRHQRIHTAEKSFRCSECGKAFSHGSNLSQHRKIHAGGRPYACAQCGRRFCRNSHLIQHERTHTGEKPFVCALCGAAFSQGSSLFKHQRVHTGEKPFACPQCGRAFSHSSNLTQHQLLHTGERPFRCVDCGKAFAKGAVLLSHRRIHTGEKPFVCTQCGRAFRERPALFHHQRIHTGEKTVRRSRASLHPQARSVAGASSEGAPAKETEPTPASGPAAVSQPAEV

• Gene ID:
• 25799

• Uniprot-ID:
• O75467

• Purification Method:
• Affinity purification