Rabbit anti-Human SEC14L2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08262P

• Product Name:
• Rabbit anti-Human SEC14L2 Polyclonal Antibody

• Synonym:
• SEC14L2; C22orf6; SPF; TAP; TAP1; SEC14-like protein 2

• Description:
• The antibody against SEC14L2 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-275 of human SEC14L2(NP_203740.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-275 of human SEC14L2(NP_203740.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SEC14L2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVK

• Gene ID:
• 23541

• Uniprot-ID:
• O76054

• Purification Method:
• Affinity purification