Rabbit anti-Human ZC3H12C Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07507P

• Product Name:
• Rabbit anti-Human ZC3H12C Polyclonal Antibody

• Synonym:
• MCPIP3; ZC3H12C

• Description:
• The antibody against ZC3H12C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 735-883 of human ZC3H12C (NP_203748.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ZC3H12C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERPGYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREKIYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY

• Gene ID:
• 85463

• Uniprot-ID:
• Q9C0D7

• Purification Method:
• Affinity purification

• Positive Samples:
• RAW264.7, U-87MG, HeLa