Rabbit anti-Human CD300LB Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07506P

• Product Name:
• Rabbit anti-Human CD300LB Polyclonal Antibody

• Synonym:
• CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2; CD300LB

• Description:
• The antibody against CD300LB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human CD300LB (NP_777552.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human CD300LB (NP_777552.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CD300LB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT

• Gene ID:
• 124599

• Uniprot-ID:
• A8K4G0

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse lung, Rat lung