Rabbit anti-Human TGF beta Receptor II (TGFBR2) Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11751P

• Product Name:
• Rabbit anti-Human TGF beta Receptor II (TGFBR2) Polyclonal Antibody

• Synonym:
• AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; tbetaR-II; TGFbeta-RII; TGF beta Receptor II (TGFBR2)

• Description:
• The antibody against TGF beta Receptor II (TGFBR2) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-280 of human TGF beta Receptor II (TGFBR2) (NP_003233.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-280 of human TGF beta Receptor II (TGFBR2) (NP_003233.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TGF beta Receptor II (TGFBR2)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEHCAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFP

• Gene ID:
• 7048

• Uniprot-ID:
• P37173

• Purification Method:
• Affinity purification

• Positive Samples:
• Rat lung, Rat uterus