Rabbit anti-Human Calmodulin 1/2/3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11752P

• Product Name:
• Rabbit anti-Human Calmodulin 1/2/3 Polyclonal Antibody

• Synonym:
• CALM1; CALML2; CAMI; CPVT4; DD132; LQT14; PHKD; caM; Calmodulin 1/2/3

• Description:
• The antibody against Calmodulin 1/2/3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin 1/2/3 (NP_008819.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin 1/2/3 (NP_008819.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Calmodulin 1/2/3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

• Gene ID:
• 801805808

• Uniprot-ID:
• P0DP23

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, U-251MG, Mouse lung, Mouse brain, Rat lung