Rabbit anti-Human TFAP2B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09166P

• Product Name:
• Rabbit anti-Human TFAP2B Polyclonal Antibody

• Synonym:
• PDA2; AP-2B; AP2-B; AP-2beta; TFAP2B

• Description:
• The antibody against TFAP2B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TFAP2B (Q92481) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TFAP2B (Q92481).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• TFAP2B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYFPPPYQPLPYHQSQDPYSHVNDPYSLNPLHQ

• Gene ID:
• 7021

• Uniprot-ID:
• Q92481

• Purification Method:
• Affinity purification

• Positive Samples:
• SH-SY5Y, U-937(Negative control)