Rabbit anti-Human RB Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-09165P

• Product Name:
• Rabbit anti-Human RB Polyclonal Antibody

• Synonym:
• RB; pRb; OSRC; pp110; p105-Rb; PPP1R130; p110-RB1

• Description:
• The antibody against RB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human RB (NP_000312.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-400 of human RB (NP_000312.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• RB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENL

• Gene ID:
• 5925

• Uniprot-ID:
• P06400

• Purification Method:
• Affinity purification

• Positive Samples:
• Jurkat, Mouse brain