Rabbit anti-Human SSR4 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01814P

• Product Name:
• Rabbit anti-Human SSR4 Polyclonal Antibody

• Synonym:
• CDG1Y; TRAPD; SSR4

• Description:
• The antibody against SSR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-144 of human SSR4 (NP_006271.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SSR4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNG

• Gene ID:
• 6748

• Uniprot-ID:
• P51571

• Purification Method:
• Affinity purification

• Positive Samples:
• LO2, U-87MG, MCF7, HL-60, Mouse liver, Mouse brain