Rabbit anti-Human S1PR2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01813P

• Product Name:
• Rabbit anti-Human S1PR2 Polyclonal Antibody

• Synonym:
• EDG5; H218; LPB2; S1P2; AGR16; EDG-5; DFNB68; Gpcr13; S1PR2

• Description:
• The antibody against S1PR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-353 of human S1PR2 (NP_004221.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-353 of human S1PR2 (NP_004221.3).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S1PR2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV

• Gene ID:
• 9294

• Uniprot-ID:
• O95136

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse heart, Rat lung, Rat heart