Rabbit anti-Human S100A10 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11881P

• Product Name:
• Rabbit anti-Human S100A10 Polyclonal Antibody

• Synonym:
• 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG; S100A10

• Description:
• The antibody against S100A10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human S100A10 (NP_002957.1).

• Species Reactivity:
• Human, Mouse, Rat, Monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• S100A10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

• Gene ID:
• 6281

• Uniprot-ID:
• P60903

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, Daudi negative, Mouse lung, Rat lung