Rabbit anti-Human eIF5A Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-11880P

• Product Name:
• Rabbit anti-Human eIF5A Polyclonal Antibody

• Synonym:
• FABAS; EIF-5A; EIF5A1; eIF-4D; eIF5AI; eIF5A

• Description:
• The antibody against eIF5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human eIF5A (NP_001137234.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human eIF5A (NP_001137234.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF5A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK

• Gene ID:
• 1984

• Uniprot-ID:
• P63241

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, 293T, Raji, 22Rv1, HepG2, K-562, U-251MG, Mouse liver, Mouse testis