Rabbit anti-Human NDUFA12 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01576P

• Product Name:
• Rabbit anti-Human NDUFA12 Polyclonal Antibody

• Synonym:
• B17.2; DAP13; MC1DN23; NDUFA12

• Description:
• The antibody against NDUFA12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human NDUFA12 (NP_061326.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• NDUFA12

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK

• Gene ID:
• 55967

• Uniprot-ID:
• Q9UI09

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, PC-12, HepG2, Mouse kidney, Mouse heart, Mouse testis, Rat heart, Rat brain