Rabbit anti-Human CHMP1B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01575P

• Product Name:
• Rabbit anti-Human CHMP1B Polyclonal Antibody

• Synonym:
• Vps46B; C10orf2; C18orf2; CHMP1.5; Vps46-2; C18-ORF2; hVps46-2; CHMP1B

• Description:
• The antibody against CHMP1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human CHMP1B (NP_065145.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-199 of human CHMP1B (NP_065145.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CHMP1B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

• Gene ID:
• 57132

• Uniprot-ID:
• Q7LBR1

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, MCF7, SKOV3, U-251MG, Mouse liver, Mouse spleen, Mouse brain