Rabbit anti-Human METTL13 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02679P

• Product Name:
• Rabbit anti-Human METTL13 Polyclonal Antibody

• Synonym:
• feat; DFNM1; CGI-01; DFNB26; DFNB26M; KIAA0859; EEF1AKNMT; 5630401D24Rik; METTL13

• Description:
• The antibody against METTL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 540-699 of human METTL13 (NP_057019.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• METTL13

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTVKIV

• Gene ID:
• 51603

• Uniprot-ID:
• Q8N6R0

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, HepG2, MCF7, K-562, Mouse heart, Mouse kidney