Rabbit anti-Human DPP8 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-02678P

• Product Name:
• Rabbit anti-Human DPP8 Polyclonal Antibody

• Synonym:
• DP8; DPRP1; DPRP-1; MST097; MSTP097; MSTP135; MSTP141; DPP8

• Description:
• The antibody against DPP8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-230 of human DPP8 (NP_932065.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 10-230 of human DPP8 (NP_932065.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DPP8

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAF

• Gene ID:
• 54878

• Uniprot-ID:
• Q6V1X1

• Purification Method:
• Affinity purification

• Positive Samples:
• HL-60, MCF7, NCI-H460, HeLa, Mouse brain, Mouse lung, Mouse skeletal muscle, Rat lung