Rabbit anti-Human MELK Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01696P

• Product Name:
• Rabbit anti-Human MELK Polyclonal Antibody

• Synonym:
• HPK38; MELK

• Description:
• The antibody against MELK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 412-651 of human MELK (NP_055606.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MELK

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

• Gene ID:
• 9833

• Uniprot-ID:
• Q14680

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T, SKOV3, HT-29, HeLa, B cells, Mouse thymus, Mouse spleen, Rat testis