Rabbit anti-Human ARPC2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-01695P

• Product Name:
• Rabbit anti-Human ARPC2 Polyclonal Antibody

• Synonym:
• ARC34; PRO2446; p34-Arc; PNAS-139; ARPC2

• Description:
• The antibody against ARPC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ARPC2 (NP_690601.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ARPC2 (NP_690601.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ARPC2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

• Gene ID:
• 10109

• Uniprot-ID:
• O15144

• Purification Method:
• Affinity purification

• Positive Samples:
• A375, U-87MG, HT-29, SGC-7901, Mouse heart, Mouse lung, Mouse spleen, Mouse thymus, Rat heart