Rabbit anti-Human MCL1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12256P

• Product Name:
• Rabbit anti-Human MCL1 Polyclonal Antibody

• Synonym:
• TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT; MCL1

• Description:
• The antibody against MCL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human MCL1 (NP_068779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MCL1 (NP_068779.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• MCL1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM

• Gene ID:
• 4170

• Uniprot-ID:
• Q07820

• Purification Method:
• Affinity purification

• Positive Samples:
• BT-474, Raji, Mouse lung, Mouse thymus