Rabbit anti-Human Bmi1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12257P

• Product Name:
• Rabbit anti-Human Bmi1 Polyclonal Antibody

• Synonym:
• PCGF4; RNF51; FLVI2/BMI1; flvi-2/bmi-1; Bmi1

• Description:
• The antibody against Bmi1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Bmi1 (NP_005171.4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• Bmi1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP

• Gene ID:
• 648

• Uniprot-ID:
• P35226

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, A-549, K-562, Mouse heart, Mouse thymus, Rat thymus, Rat testis