Rabbit anti-Human LHB/CGB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08459P

• Product Name:
• Rabbit anti-Human LHB/CGB1 Polyclonal Antibody

• Synonym:
• LHB; CGB4; HH23; LSH-B; LSH-beta; lutropin subunit beta; Lutropin subunit beta

• Description:
• The antibody against LHB/CGB1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 21-141of human LHB(NP_000885.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 21-141of human LHB(NP_000885.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• LHB/CGB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

• Gene ID:
• 3972

• Uniprot-ID:
• P01229

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T transfected with LHB/CGB1