Rabbit anti- CXCR3-B Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08460P

• Product Name:
• Rabbit anti- CXCR3-B Polyclonal Antibody

• Synonym:
• GPR9; MigR; CD182; CD183; Mig-R; CKR-L2; CMKAR3; IP10-R; CXCR3

• Description:
• The antibody against CXCR3-B was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-100 human CXCR3-B(NP_001136269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-100 human CXCR3-B(NP_001136269.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CXCR3-B

• Form:
• Liquid

• Immunogen Sequence:
• MELRKYGPGRLAGTVIGGAAQSKSQTKSDSITKEFLPGLYTAPSSPFPPSQVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

• Gene ID:
• 2833

• Uniprot-ID:
• P49682-2

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse spleen