Rabbit anti-Human HSP27/HSPB1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08438P

• Product Name:
• Rabbit anti-Human HSP27/HSPB1 Polyclonal Antibody

• Synonym:
• HSPB1; CMT2F; HEL-S-102; HMN2B; HS.76067; HSP27; HSP28; Hsp25; SRP27; heat shock protein beta-1; HSP27/HSPB1

• Description:
• The antibody against HSP27/HSPB1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-205 of human HSP27/HSPB1(NP_001531.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-205 of human HSP27/HSPB1(NP_001531.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HSP27/HSPB1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

• Gene ID:
• 3315

• Uniprot-ID:
• P04792

• Purification Method:
• Affinity purification

• Positive Samples:
• Hep G2, HEL(Low expression control)