Rabbit anti-Human CCL8/MCP-2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08439P

• Product Name:
• Rabbit anti-Human CCL8/MCP-2 Polyclonal Antibody

• Synonym:
• CCL8; HC14; MCP-2; MCP2; SCYA10; SCYA8; C-C motif chemokine 8; CCL8/MCP-2

• Description:
• The antibody against CCL8/MCP-2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-99 of human CCL8/MCP-2 (NP_005614.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-99 of human CCL8/MCP-2 (NP_005614.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CCL8/MCP-2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP

• Gene ID:
• 6355

• Uniprot-ID:
• P80075

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T transfected with CCL8/MCP-2