Rabbit anti-Human HP1 alpha/CBX5 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13177P

• Product Name:
• Rabbit anti-Human HP1 alpha/CBX5 Polyclonal Antibody

• Synonym:
• HP1; HP1A; HEL25; X5

• Description:
• The antibody against HP1 alpha/CBX5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• HP1 alpha/CBX5

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD

• Gene ID:
• 23468

• Uniprot-ID:
• P45973

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, Jurkat, SH-SY5Y, A-549, MCF7, Mouse brain, 293T