Rabbit anti-Human CRMP2/DPYSL2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-13176P

• Product Name:
• Rabbit anti-Human CRMP2/DPYSL2 Polyclonal Antibody

• Synonym:
• DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; L2

• Description:
• The antibody against CRMP2/DPYSL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human CRMP2/CRMP2/DPYSL2 (NP_001377.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 400-500 of human CRMP2/CRMP2/DPYSL2 (NP_001377.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CRMP2/DPYSL2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• RIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD

• Gene ID:
• 1808

• Uniprot-ID:
• Q16555

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, U-251MG, 293T