Rabbit anti-Human GSK-3α/β Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07636P

• Product Name:
• Rabbit anti-Human GSK-3α/β Polyclonal Antibody

• Synonym:
• GSK3B; gsk-3β; GSK-3α/β

• Description:
• The antibody against GSK-3α/β was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 253-368 of human GSK-3α/β (NP_063937.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 253-368 of human GSK-3α/β (NP_063937.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• GSK-3α/β

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVF

• Gene ID:
• 2931 2932

• Uniprot-ID:
• P49840

• Purification Method:
• Affinity purification

• Positive Samples:
• U-87MG, A-431, HeLa, B-cell, Mouse liver