Rabbit anti-Human G6PC Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07637P

• Product Name:
• Rabbit anti-Human G6PC Polyclonal Antibody

• Synonym:
• G6PC; G6PT; GSD1; GSD1a; G6Pase

• Description:
• The antibody against G6PC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human G6PC (NP_000142.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human G6PC (NP_000142.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• G6PC

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIV

• Gene ID:
• 2538

• Uniprot-ID:
• P35575

• Purification Method:
• Affinity purification

• Positive Samples:
• Huh-7