Rabbit anti-Human FMR1NB Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03855P

• Product Name:
• Rabbit anti-Human FMR1NB Polyclonal Antibody

• Synonym:
• CT37; NYSAR35; NY-SAR-35; FMR1NB

• Description:
• The antibody against FMR1NB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-183 of human FMR1NB (NP_689791.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 90-183 of human FMR1NB (NP_689791.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• FMR1NB

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LCSGSSYFVLANGHILPNSENAHGQSLEEDSALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDVPKQ

• Gene ID:
• 158521

• Uniprot-ID:
• Q8N0W7

• Purification Method:
• Affinity purification

• Positive Samples:
• NCI-H460, K-562, Mouse brain, Mouse liver, Rat liver, Rat brain