Rabbit anti-Human DHX36 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-03854P

• Product Name:
• Rabbit anti-Human DHX36 Polyclonal Antibody

• Synonym:
• G4R1; RHAU; DDX36; MLEL1; DHX36

• Description:
• The antibody against DHX36 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human DHX36 (NP_065916.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human DHX36 (NP_065916.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DHX36

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKGSACRIV

• Gene ID:
• 170506

• Uniprot-ID:
• Q9H2U1

• Purification Method:
• Affinity purification

• Positive Samples:
• Mouse brain, Mouse liver, Mouse kidney, Rat brain