Rabbit anti-Human eIF4A1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12522P

• Product Name:
• Rabbit anti-Human eIF4A1 Polyclonal Antibody

• Synonym:
• DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; eIF4A1

• Description:
• The antibody against eIF4A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.01% thimerosal, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• eIF4A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA

• Gene ID:
• 1973

• Uniprot-ID:
• P60842

• Purification Method:
• Affinity purification

• Positive Samples:
• HepG2, 293T, C2C12, C6, Mouse brain