Rabbit anti-Human CS Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-12521P

• Product Name:
• Rabbit anti-Human CS Polyclonal Antibody

• Synonym:
• CS

• Description:
• The antibody against CS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-466 of human CS (NP_004068.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 167-466 of human CS (NP_004068.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CS

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

• Gene ID:
• 1431

• Uniprot-ID:
• O75390

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa, SW620, 293T, Mouse heart, Rat heart