Rabbit anti-Human DIAPH1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07190P

• Product Name:
• Rabbit anti-Human DIAPH1 Polyclonal Antibody

• Synonym:
• DIA1; DRF1; DFNA1; LFHL1; SCBMS; hDIA1; mDia1; [KD Validated] DIAPH1

• Description:
• The antibody against DIAPH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1158-1272 of human DIAPH1 (NP_005210.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1272 of human DIAPH1 (NP_005210.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• DIAPH1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS

• Gene ID:
• 1729

• Uniprot-ID:
• O60610

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T