Rabbit anti- SnRK2.3 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-07191P

• Product Name:
• Rabbit anti- SnRK2.3 Polyclonal Antibody

• Synonym:
• SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3; SnRK2.3

• Description:
• The antibody against SnRK2.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1).

• Species Reactivity:
• Arabidopsis thaliana

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• SnRK2.3

• Form:
• Liquid

• Immunogen Sequence:
• DVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE

• Gene ID:
• 836822

• Uniprot-ID:
• Q39193

• Purification Method:
• Affinity purification

• Positive Samples:
• Inflorescence