• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Polyclonal Antibody >

Rabbit anti- SnRK2.3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • ADA-07191P
  • Product Name:
  • Rabbit anti- SnRK2.3 Polyclonal Antibody
  • Synonym:
  • SNRK2-3; SRK2I; SUCROSE NONFERMENTING 1 (SNF1)-RELATED PROTEIN KINASE 2-3; sucrose nonfermenting 1(SNF1)-related protein kinase 2.3; SnRK2.3
  • Description:
  • The antibody against SnRK2.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 200-300 of arabidopsis thaliana SnRK2.3 (NP_201489.1).
  • Species Reactivity:
  • Arabidopsis thaliana
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Target Name:
  • SnRK2.3
  • Form:
  • Liquid
  • Immunogen Sequence:
  • DVWSCGVTLYVMLVGAYPFEDPEEPRDYRKTIQRILSVKYSIPDDIRISPECCHLISRIFVADPATRISIPEIKTHSWFLKNLPADLMNESNTGSQFQEPE
  • Gene ID:
  • 836822
  • Purification Method:
  • Affinity purification
  • Positive Samples:
  • Inflorescence
  • Pre product:Rabbit anti-Human DIAPH1 Polyclonal Antibody-ADA-07190P
  • Online Inquiry

    refresh