Rabbit anti-Human CYP11B2 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08311P

• Product Name:
• Rabbit anti-Human CYP11B2 Polyclonal Antibody

• Synonym:
• CYP11B2; ALDOS; CPN2; CYP11B; CYP11BL; CYPXIB2; P-450C18; P450C18; P450aldo; cytochrome P450 11B2; mitochondrial

• Description:
• The antibody against CYP11B2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP11B2(NP_000489.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP11B2(NP_000489.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CYP11B2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKL

• Gene ID:
• 1585

• Uniprot-ID:
• P19099

• Purification Method:
• Affinity purification

• Positive Samples:
• 293T cells transfected with CYP11B2