Rabbit anti-Human ACSL1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08310P

• Product Name:
• Rabbit anti-Human ACSL1 Polyclonal Antibody

• Synonym:
• ACSL1; ACS1; FACL1; FACL2; LACS; LACS1; LACS2; long-chain-fatty-acid--CoA ligase 1

• Description:
• The antibody against ACSL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 590-698 of human ACSL1(NP_001986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 590-698 of human ACSL1(NP_001986.2).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• ACSL1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GESLQAFLIAIVVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV

• Gene ID:
• 2180

• Uniprot-ID:
• P33121

• Purification Method:
• Affinity purification

• Positive Samples:
• RAW 264.7