Rabbit anti-Human COX7A2L Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08124P

• Product Name:
• Rabbit anti-Human COX7A2L Polyclonal Antibody

• Synonym:
• EB1; SCAF1; SCAFI; SIG81; COX7AR; COX7RP; [KD Validated] COX7A2L

• Description:
• The antibody against COX7A2L was raised in Rabbit using the recombinant protein of human COX7A2L as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human COX7A2L.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• COX7A2L

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

• Gene ID:
• 9167

• Uniprot-ID:
• O14548

• Purification Method:
• Affinity purification

• Positive Samples:
• HeLa