Rabbit anti-Human CLIC1 Polyclonal Antibody Online Inquiry

• Cat#:
• ADA-08125P

• Product Name:
• Rabbit anti-Human CLIC1 Polyclonal Antibody

• Synonym:
• G6; CL1C1; NCC27; CLCNL1; [KD Validated] CLIC1

• Description:
• The antibody against CLIC1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 42-241 of human CLIC1(NP_001279.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 42-241 of human CLIC1(NP_001279.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Target Name:
• CLIC1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

• Gene ID:
• 1192

• Uniprot-ID:
• O00299

• Purification Method:
• Affinity purification

• Positive Samples:
• MCF7, 293T