Rabbit anti-Mouse PE Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08265P

• Product Name:
• Rabbit anti-Mouse PE Monoclonal Antibody

• Synonym:
• W; Bs; Fdc; Ssm; SCO1; SCO5; SOW3; CD117; c-KIT; Tr-kit; Gsfsco1; Gsfsco5; Gsfsow3

• Description:
• The antibody against PE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-523 of mouse CD117/c-Kit (NP_001116205.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 25-523 of mouse CD117/c-Kit (NP_001116205.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PE

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

• Gene ID:
• 16590

• Uniprot-ID:
• P05532

• Positive Samples:
• Affinity purification