Rabbit anti-Human PE Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08274P

• Product Name:
• Rabbit anti-Human PE Monoclonal Antibody

• Synonym:
• ITGB5; integrin beta-5

• Description:
• The antibody against PE was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 24-490 of human Integrin β5/ITGB5 (NP_002204.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 24-490 of human Integrin β5/ITGB5 (NP_002204.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PE

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS

• Gene ID:
• 3693

• Uniprot-ID:
• P18084

• Positive Samples:
• Affinity purification