Rabbit anti-Mouse LAMP1/CD107a Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15459P

• Product Name:
• Rabbit anti-Mouse LAMP1/CD107a Monoclonal Antibody

• Synonym:
• P2B; Perk; LGP-A; CD107a; Lamp-1; LGP-120; LAMP1/CD107a

• Description:
• The antibody against LAMP1/CD107a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a（NP_034814.2） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 208-363 of mouse LAMP1/CD107a（NP_034814.2）.

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• LAMP1/CD107a

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE

• Gene ID:
• 16783

• Uniprot-ID:
• P11438

• Purification Method:
• C2C12, NIH/3T3

• Positive Samples:
• Affinity purification