Rabbit anti-Human E2A/TCF3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15460P

• Product Name:
• Rabbit anti-Human E2A/TCF3 Monoclonal Antibody

• Synonym:
• TCF3; AGM8; E2A; E47; ITF1; TCF-3; VDIR; bHLHb21; transcription factor 3; E2A/TCF3

• Description:
• The antibody against E2A/TCF3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 379-525 of human E2A/TCF3（NP_003191.1） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 379-525 of human E2A/TCF3（NP_003191.1）.

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• E2A/TCF3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPR

• Gene ID:
• 6929

• Uniprot-ID:
• P15923

• Purification Method:
• Jurkat, Mouse ovary

• Positive Samples:
• Affinity purification