Rabbit anti-Mouse CD69 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15598P

• Product Name:
• Rabbit anti-Mouse CD69 Monoclonal Antibody

• Synonym:
• AIM; VEA; 5830438K24Rik; CD69

• Description:
• The antibody against CD69 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to aminoacids 64-199 of mouse CD69(NP_001028294.1).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD69

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR

• Gene ID:
• 12515

• Uniprot-ID:
• P37217

• Positive Samples:
• Affinity purification