Rabbit anti-Human CD8β Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15597P

• Product Name:
• Rabbit anti-Human CD8β Monoclonal Antibody

• Synonym:
• LY3; P37; LEU2; LYT3; Ly-3; CD8B1; CD8beta; CD8β

• Description:
• The antibody against CD8β was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_004922.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-170 of human CD8B (NP_004922.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD8β

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

• Gene ID:
• 926

• Uniprot-ID:
• P10966

• Purification Method:
• 293T transfected with CD8β (Human)

• Positive Samples:
• Affinity purification