Rabbit anti-Mouse ASC/TMS1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15680P

• Product Name:
• Rabbit anti-Mouse ASC/TMS1 Monoclonal Antibody

• Synonym:
• Asc; TNS1; masc; CARD5; TMS-1; 9130417A21Rik; ASC/TMS1

• Description:
• The antibody against ASC/TMS1 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1-93 of mouse ASC/TMS1(NP_075747.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 1-93 of mouse ASC/TMS1(NP_075747.3).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ASC/TMS1

• Form:
• Liquid

• Immunogen Species:
• Mouse

• Immunogen Sequence:
• MGRARDAILDALENLSGDELKKFKMKLLTVQLREGYGRIPRGALLQMDAIDLTDKLVSYYLESYGLELTMTVLRDMGLQELAEQLQTTKEESG

• Gene ID:
• 66824

• Uniprot-ID:
• Q9EPB4

• Purification Method:
• Mouse spleen, Rat lung

• Positive Samples:
• Affinity purification