Rabbit anti- Histone H2B (testis specific)  Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15679P

• Product Name:
• Rabbit anti- Histone H2B (testis specific)  Monoclonal Antibody

• Synonym:
• STBP; TH2B; H2BFU; TSH2B; hTSH2B; TSH2B.1; HIST1H2BA; bA317E16.3; Histone H2B (testis specific)?

• Description:
• The antibody against Histone H2B (testis specific)  was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1).

• Species Reactivity:
• Human, Mouse, Rat, Other (Wide Range Predicted)

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Histone H2B (testis specific) 

• Form:
• Liquid

• Immunogen Sequence:
• MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV

• Gene ID:
• 255626

• Uniprot-ID:
• Q96A08

• Purification Method:
• 293F transfected with Histone H2B (testis specific) (Human), Mouse testis, Rat testis, Rat testis

• Positive Samples:
• Affinity purification