Rabbit anti-Human WNK1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13838P

• Product Name:
• Rabbit anti-Human WNK1 Monoclonal Antibody

• Synonym:
• KDP; PSK; p65; HSN2; HSAN2; PRKWNK1; PPP1R167; WNK1

• Description:
• The antibody against WNK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WNK1 (Q9H4A3).

• Species Reactivity:
• Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• WNK1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPL

• Gene ID:
• 65125

• Uniprot-ID:
• Q9H4A3

• Purification Method:
• Mouse kidney

• Positive Samples:
• Affinity purification