Rabbit anti-Human NBS1/NBN Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13837P

• Product Name:
• Rabbit anti-Human NBS1/NBN Monoclonal Antibody

• Synonym:
• ATV; NBS; P95; NBS1; AT-V1; AT-V2; NBS1/NBN

• Description:
• The antibody against NBS1/NBN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 655-754 of human NBS1/NBN (O60934) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 655-754 of human NBS1/NBN (O60934).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NBS1/NBN

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR

• Gene ID:
• 4683

• Uniprot-ID:
• O60934

• Purification Method:
• 239T, HeLa

• Positive Samples:
• Affinity purification