Rabbit anti-Human Ubiquitin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15274P

• Product Name:
• Rabbit anti-Human Ubiquitin Monoclonal Antibody

• Synonym:
• HEL-S-50; Ubiquitin

• Description:
• The antibody against Ubiquitin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Ubiquitin (NP_061828.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Ubiquitin (NP_061828.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Ubiquitin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE

• Gene ID:
• 7314

• Uniprot-ID:
• P0CG47

• Purification Method:
• U-251 MG, Hep G2, A549, HeLa

• Positive Samples:
• Affinity purification