Rabbit anti-Human TRAP1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15273P

• Product Name:
• Rabbit anti-Human TRAP1 Monoclonal Antibody

• Synonym:
• HSP75; HSP 75; HSP90L; TRAP-1; TRAP1

• Description:
• The antibody against TRAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 580-680 of human TRAP1 (NP_057376.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• TRAP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAA

• Gene ID:
• 10131

• Uniprot-ID:
• Q12931

• Purification Method:
• HCT116

• Positive Samples:
• Affinity purification